Proteintech, 84583-4-RR, Granzyme A Recombinant monoclonal antibody

Size: 20ul / 100ul The Granzyme A (84583-4-RR) by Proteintech is a Recombinant antibody targeting Granzyme A in WB, ELISA applications with reactivity to human samples 84583-4-RR targets Granzyme A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NK-92 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Granzyme A(GrA, a tryptase) is necessary for target cell lysis in cell-mediated immune responses. It activates mitochondrial outer membrane permeabilization- and caspase-independent cell death pathways by cleaving the mitochondrial complex I component NDUFS3after lys56. Among serine proteases GrA has an unique quaternary structure consisting of a disulphide-linked homodimer of 60kDa linked via Cys93.(PMID: 12819769) This protein has 2 isoforms produced by alternative promoter usage with the MW of 29 and 27 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1818 Product name: Recombinant human GZMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-262 aa of BC015739 Sequence: MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV Predict reactive species Full Name: granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC015739 Gene Symbol: Granzyme A Gene ID (NCBI): 3001 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P12544 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.