Iright
BRAND / VENDOR: Proteintech

Proteintech, 84605-4-RR, Pregnancy Zone Protein Recombinant monoclonal antibody

CATALOG NUMBER: 84605-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Pregnancy Zone Protein (84605-4-RR) by Proteintech is a Recombinant antibody targeting Pregnancy Zone Protein in WB, ELISA applications with reactivity to human samples 84605-4-RR targets Pregnancy Zone Protein in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Pregnancy Zone Protein (PZP) is an immunosuppressive protein that is expressed by the placenta. The PZP is a thiol ester-containing alpha macroglobulin protein that controls the proteolytic pathways during pregnancy and contributes to maintaining the immunologically privileged status of the fetus. Recently PZP over-expression has been described as a novel biomarker for predicting the prognosis of hepatocellular carcinoma and its high expression has been reported in solid tumors. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16471 Product name: Recombinant human PZP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-690 aa of BC111756 Sequence: ITAHYTLNRQAMGELSELSFHYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFAILPDGEVVGDSEKFEIENCLANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSVLLMKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVL Predict reactive species Full Name: pregnancy-zone protein Calculated Molecular Weight: 1482 aa, 164 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC111756 Gene Symbol: Pregnancy Zone Protein Gene ID (NCBI): 5858 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P20742 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924