Iright
BRAND / VENDOR: Proteintech

Proteintech, 84617-7-RR, CD82 Recombinant monoclonal antibody

CATALOG NUMBER: 84617-7-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CD82 (84617-7-RR) by Proteintech is a Recombinant antibody targeting CD82 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84617-7-RR targets CD82 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells, U-87 MG cells Positive IHC detected in: human tonsillitis tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information CD82 is a membrane glycoprotein and belongs to the tetraspanin superfamily, many of which are implicated in the regulation of cell motility, morphology, fusion, signaling, fertilization, and differentiation. CD82 was originally identified as a suppressor of metastasis located on human chromosome 11p11.2 in prostate carcinoma. The majority of evidence indicates that CD82 expression is downregulated or abolished in a variety of malignant tumors. CD82 is present at high levels in human monocyte and macrophage lineages and in various epithelial cells in the prostate, lung, pancreas and many other tissues. In epithelial cells, CD82 is implicated in diverse biological processes such as cell adhesion, migration, apoptosis and morphogenesis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1749 Product name: Recombinant Human CD82 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 111-228 aa of NM_002231.4 Sequence: GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENL Predict reactive species Full Name: CD82 molecule Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 35-45 kDa GenBank Accession Number: NM_002231.4 Gene Symbol: CD82 Gene ID (NCBI): 3732 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P27701-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924