Proteintech, 84622-1-RR, SETD5 Recombinant monoclonal antibody

Size: 20ul / 100ul The SETD5 (84622-1-RR) by Proteintech is a Recombinant antibody targeting SETD5 in IHC, IF/ICC, ELISA applications with reactivity to human samples 84622-1-RR targets SETD5 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SETD5, also known as KIAA1757, is a member of the histone lysine methyltransferase family. It has 3 isoforms and is involved in a variety of cellular functions, including cell cycle regulation and cell proliferation, and has a potential role in early embryonic development (PMID: 36875494). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28929 Product name: Recombinant human SETD5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-202 aa of BC020956 Sequence: MHAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVE Predict reactive species Full Name: SET domain containing 5 GenBank Accession Number: BC020956 Gene Symbol: SETD5 Gene ID (NCBI): 55209 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9C0A6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.