Proteintech, 84624-4-RR, ZNF649 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZNF649 (84624-4-RR) by Proteintech is a Recombinant antibody targeting ZNF649 in WB, ELISA applications with reactivity to human samples 84624-4-RR targets ZNF649 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, HCT116 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ZNF649, also named as Zinc finger protein 649, is a 505 amino acid protein, which contains The one KRAB domain and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF649 is highly expressed in heart, skeletal muscle, and brain and lower expression in liver, lung, kidney, pancreas and placenta. ZNF649 as a regulator of transcriptional factor complexes may suppress SRE and AP-1 transcription activities by growth factor signaling pathways. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22700 Product name: Recombinant human ZNF649 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-183 aa of BC005368 Sequence: LWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESRKPISTKSQFLKHQQTHNIEKAHECTDC Predict reactive species Full Name: zinc finger protein 649 Calculated Molecular Weight: 505 aa, 58 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC005368 Gene Symbol: ZNF649 Gene ID (NCBI): 65251 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BS31 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.