Iright
BRAND / VENDOR: Proteintech

Proteintech, 84662-4-RR, FceR1a Recombinant monoclonal antibody

CATALOG NUMBER: 84662-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FceR1a (84662-4-RR) by Proteintech is a Recombinant antibody targeting FceR1a in WB, ELISA applications with reactivity to human, mouse samples 84662-4-RR targets FceR1a in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MC/9 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Fc epsilon Receptor I alpha (FceR1a) is a single-pass type I membrane protein that contains 2 immunoglobulin-like domains. FceR1a forms a tetrameric complex, FceRI, with one beta and two gamma subunits (PMID: 19406478). FceRI is the high-affinity receptor for the Fc region of immunoglobulin E (IgE) (PMID: 1532373). It is expressed on mast cells and basophils and plays a central role in the allergic response (PMID: 2148316). The calculated molecular weight of FceR1a is 30 kDa, the 55- to 70-kDa bands detected by this antibody are probably caused by heterogeneous glycosylation (PMID: 11344350; 12671054). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2022 Product name: Recombinant Human Fc Epsilon RI Alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-205 aa of NM_001387280.1 Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ Predict reactive species Full Name: Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_001387280.1 Gene Symbol: FceR1a Gene ID (NCBI): 2205 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P12319 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924