Proteintech, 84664-4-RR, COMMD4 Recombinant monoclonal antibody

Size: 20ul / 100ul The COMMD4 (84664-4-RR) by Proteintech is a Recombinant antibody targeting COMMD4 in WB, IHC, ELISA applications with reactivity to human, rat samples 84664-4-RR targets COMMD4 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, HeLa cells, HEK-293T cells, U2OS cells Positive IHC detected in: rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information COMMD4 is a protein-coding gene belonging to the COMMD family and is highly expressed in non-small cell lung cancer (NSCLC) and hepatocellular carcinoma (HCC) (PMID: 36249824). It has 3 isoforms and has been shown to control NF-κB activity and regulate the activity of cullin-RING E3 ubiquitin ligases (PMID: 32439936). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34904 Product name: Recombinant human COMMD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC068998 Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG Predict reactive species Full Name: COMM domain containing 4 Observed Molecular Weight: 25 kDa GenBank Accession Number: BC068998 Gene Symbol: COMMD4 Gene ID (NCBI): 54939 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H0A8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.