Proteintech, 84669-2-RR, KAT2A/GCN5 Recombinant monoclonal antibody

Size: 20ul / 100ul The KAT2A/GCN5 (84669-2-RR) by Proteintech is a Recombinant antibody targeting KAT2A/GCN5 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples 84669-2-RR targets KAT2A/GCN5 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, A431 cells, HeLa cells, MCF-7 cells, LNCaP cells, HSC-T6 cells Positive IHC detected in: human colon cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29005 Product name: Recombinant human KAT2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 366-449 aa of BC032743 Sequence: EIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLR Predict reactive species Full Name: K(lysine) acetyltransferase 2A Calculated Molecular Weight: 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC032743 Gene Symbol: KAT2A Gene ID (NCBI): 2648 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.