Proteintech, 84703-3-RR, APLP2 Recombinant monoclonal antibody

Size: 20ul / 100ul The APLP2 (84703-3-RR) by Proteintech is a Recombinant antibody targeting APLP2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84703-3-RR targets APLP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse brain tissue, SH-SY5Y cells, HEK-293 cells Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Amyloid precursor-like protein-2 (APLP2) is a member of the APP (amyloid precursor protein) family including APP, APLP1, and APLP2. APLP2 is ubiquitously expressed. It contains heparin-, copper- and zinc- binding domains at the N-terminus, BPTI/Kunitz inhibitor and E2 domains in the middle region, and transmembrane and intracellular domains at the C-terminus. APLP2 has been shown to regulate multiple cellular functions such as neurite outgrowth, axogenesis, corneal epithelial wound healing, cell adhesion, migration, and mitosis. The synergy of this protein and the APP is required to mediate neuromuscular transmission, spatial learning and synaptic plasticity. APLP2 has been implicated in the pathogenesis of Alzheimer's disease. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6842 Product name: Recombinant human APLP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 33-360 aa of BC000373 Sequence: YIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC Predict reactive species Full Name: amyloid beta (A4) precursor-like protein 2 Calculated Molecular Weight: 87 kDa Observed Molecular Weight: 95-120 kDa GenBank Accession Number: BC000373 Gene Symbol: APLP2 Gene ID (NCBI): 334 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q06481 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.