Iright
BRAND / VENDOR: Proteintech

Proteintech, 84738-2-RR, EVI5 Recombinant monoclonal antibody

CATALOG NUMBER: 84738-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EVI5 (84738-2-RR) by Proteintech is a Recombinant antibody targeting EVI5 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 84738-2-RR targets EVI5 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information EVI5 functions as a regulator of cell cycle progression by stabilizing the FBXO5 protein and promoting cyclin-A accumulation during interphase. It may play a role in cytokinesis (PMID: 16439210). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26739 Product name: Recombinant human EVI5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC156793 Sequence: MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSP Predict reactive species Full Name: ecotropic viral integration site 5 Calculated Molecular Weight: 810 aa, 93 kDa GenBank Accession Number: BC156793 Gene Symbol: EVI5 Gene ID (NCBI): 7813 RRID: AB_3672122 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O60447 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924