Iright
BRAND / VENDOR: Proteintech

Proteintech, 84744-1-RR, TTK Recombinant monoclonal antibody

CATALOG NUMBER: 84744-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TTK (84744-1-RR) by Proteintech is a Recombinant antibody targeting TTK in WB, ELISA applications with reactivity to human, mouse, rat samples 84744-1-RR targets TTK in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, DU 145 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Mps1 family of kinases colocalizes with mitotic checkpoint proteins in kinetochores and/or spindle pole bodies/centrosomes. TTK has been shown to be a cell cycle-regulated kinase displaying maximum activity during M phase(PMID:15618221). Its kinase activity is required for proper chromosome segregation during mitosis through its involvements in microtubule-chromosome attachment error correction and the mitotic checkpoint(PMID:20937696). TTK mRNA is present at relatively high levels in testis and thymus, tissues which contain a large number of proliferating cells, but is not detected in most other benign tissues (PMID:1639825). It has 2 isoforms produced by alternative splicing (PMID:25137017). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20556 Product name: Recombinant human TTK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 536-789 aa of BC000633 Sequence: SSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHP Predict reactive species Full Name: TTK protein kinase Calculated Molecular Weight: 97 kDa Observed Molecular Weight: 97 kDa GenBank Accession Number: BC000633 Gene Symbol: TTK Gene ID (NCBI): 7272 RRID: AB_3672129 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P33981 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924