Iright
BRAND / VENDOR: Proteintech

Proteintech, 84762-3-RR, CACNB3 Recombinant monoclonal antibody

CATALOG NUMBER: 84762-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CACNB3 (84762-3-RR) by Proteintech is a Recombinant antibody targeting CACNB3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 84762-3-RR targets CACNB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse brain tissue, HeLa cells, SH-SY5Y cells, SKOV-3 cells, SW480 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CACNB3, also known as CACNLB3, is a voltage-gated Ca2+ channel subunit. It has 5 isoforms and may play a role in the regulation of transcription factors and calcium transport. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35651 Product name: Recombinant human CACNB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-484 aa of NM_000725.3 Sequence: EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY Predict reactive species Full Name: calcium channel, voltage-dependent, beta 3 subunit Calculated Molecular Weight: 55kDa,484aa Observed Molecular Weight: 58 kDa GenBank Accession Number: NM_000725.3 Gene Symbol: CACNB3 Gene ID (NCBI): 784 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P54284 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924