Iright
BRAND / VENDOR: Proteintech

Proteintech, 84762-4-RR, CACNB3 Recombinant monoclonal antibody

CATALOG NUMBER: 84762-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CACNB3 (84762-4-RR) by Proteintech is a Recombinant antibody targeting CACNB3 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84762-4-RR targets CACNB3 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: SKOV-3 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CACNB3, also known as CACNLB3, is a voltage-gated Ca2+ channel subunit. It has 5 isoforms and may play a role in the regulation of transcription factors and calcium transport. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35651 Product name: Recombinant human CACNB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-484 aa of NM_000725.3 Sequence: EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY Predict reactive species Full Name: calcium channel, voltage-dependent, beta 3 subunit Calculated Molecular Weight: 55kDa,484aa GenBank Accession Number: NM_000725.3 Gene Symbol: CACNB3 Gene ID (NCBI): 784 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P54284 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924