Proteintech, 84767-4-RR, PSMD14/POH1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PSMD14/POH1 (84767-4-RR) by Proteintech is a Recombinant antibody targeting PSMD14/POH1 in IF/ICC, ELISA applications with reactivity to human samples 84767-4-RR targets PSMD14/POH1 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: A375 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information The PSMD14 (POH1, also known as Rpn11/MPR1/S13/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in the heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection considerably impacted cell viability, causing cell arrest in the G0-G1 phase, ultimately leading to senescence. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2694 Product name: Recombinant human PSMD14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC009524 Sequence: MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 Calculated Molecular Weight: 35 kDa GenBank Accession Number: BC009524 Gene Symbol: PSMD14 Gene ID (NCBI): 10213 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O00487 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.