Iright
BRAND / VENDOR: Proteintech

Proteintech, 84779-4-RR, cIAP2 Recombinant monoclonal antibody

CATALOG NUMBER: 84779-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The cIAP2 (84779-4-RR) by Proteintech is a Recombinant antibody targeting cIAP2 in WB, FC (Intra), IP, ELISA applications with reactivity to human samples 84779-4-RR targets cIAP2 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells Positive IP detected in: Raji cells Positive FC (Intra) detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information cIAP2 also known as BIRC3, is a member of the Inhibitor of Apoptosis Protein (IAP) family. cIAP2 is induced by inflammatory stimuli and plays a critical role in regulating adaptive and innate immune responses, cell death, and the production of inflammatory mediators. Its dysregulation is associated with various diseases, including cancer and neuroinflammatory conditions. Understanding the mechanisms by which cIAP2 functions and interacts with other cellular components is essential for developing targeted therapies. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20500 Product name: Recombinant human BIRC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-169 aa of BC027485 Sequence: RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE Predict reactive species Full Name: baculoviral IAP repeat-containing 3 Calculated Molecular Weight: 604 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC027485 Gene Symbol: cIAP2 Gene ID (NCBI): 330 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13489 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924