Proteintech, 84782-5-RR, IGF1 Recombinant monoclonal antibody

Size: 20ul / 100ul The IGF1 (84782-5-RR) by Proteintech is a Recombinant antibody targeting IGF1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to rat samples 84782-5-RR targets IGF1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: rat plasma Positive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Transfected HEK-293T cells Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IGF1, also named as IBP1, MGF, IGF-IA, and Somatomedin-C, belongs to the INS family. IGF1 is structurally and functionally related to INS but has a much higher growth-promoting activity. Altered expression or mutation of IGF-1 is associated with several human disorders, including type I diabetes and various forms of cancer. Defects in IGF1 are the cause of INS-like growth factor I deficiency (IGF1 deficiency) which is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness, and mental retardation. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1976 Product name: Recombinant Rat IGF1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 23-92 aa of AAA41386 Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA Predict reactive species Full Name: insulin-like growth factor 1 Calculated Molecular Weight: 14kd Observed Molecular Weight: 12 kDa GenBank Accession Number: AAA41386 Gene Symbol: Igf1 Gene ID (NCBI): 24482 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08025 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.