Proteintech, 84797-4-RR, MCT4 Recombinant monoclonal antibody

Size: 20ul / 100ul The MCT4 (84797-4-RR) by Proteintech is a Recombinant antibody targeting MCT4 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 84797-4-RR targets MCT4 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, PC-3 cells Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information The monocarboxylate transporter 4 (MCT4, also known as SLC16A3) is involved in the transportation of metabolically important monocarboxylates such as lactate, pyruvate, acetate and ketone bodies. It is widely expressed, particularly strongly in glycolytic tissues such as white skeletal muscle fibres, astrocytes, white blood cells, chondrocytes and some mammalian cell lines. MCT4 is also linked to tumor biology because it mediates lactate transport across membranes resulting in antiapoptotic effects. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18788 Product name: Recombinant human SLC16A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 402-465 aa of BC112269 Sequence: LLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV Predict reactive species Full Name: solute carrier family 16, member 3 (monocarboxylic acid transporter 4) Calculated Molecular Weight: 465 aa, 49 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC112269 Gene Symbol: MCT4 Gene ID (NCBI): 9123 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O15427 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.