Proteintech, 84810-4-RR, ACSS3 Recombinant monoclonal antibody

Size: 20ul / 100ul The ACSS3 (84810-4-RR) by Proteintech is a Recombinant antibody targeting ACSS3 in WB, ELISA applications with reactivity to human samples 84810-4-RR targets ACSS3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information ACSS3(acyl-CoA synthetase short-chain family member 3, mitochondrial) belongs to the ATP-dependent AMP-binding enzyme family. It activates acetate so that it can be used for lipid synthesis or for energy generation. The deduced 686-amino acid protein contains 4 of 5 motifs characteristic of acyl-CoA synthetases. This protein has 2 isoforms produced by alternative splicing. The full length protein has a transit peptide with 29 amino acids. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9173 Product name: Recombinant human ACSS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-686 aa of BC009317 Sequence: DLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA Predict reactive species Full Name: acyl-CoA synthetase short-chain family member 3 Calculated Molecular Weight: 686 aa, 75 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC009317 Gene Symbol: ACSS3 Gene ID (NCBI): 79611 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9H6R3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.