Proteintech, 84830-5-RR, DGKZ Recombinant monoclonal antibody

Size: 20ul / 100ul The DGKZ (84830-5-RR) by Proteintech is a Recombinant antibody targeting DGKZ in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84830-5-RR targets DGKZ in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Diacylglycerol kinase zeta (DGKZ), also known as DAGK5, DAGK6, DGK-ZETA, hDGKzeta, belongs to the diacylglycerol kinase (DGK) family which catalyzes diacylglycerol (DAG) into phosphatidic acid (PA). DGKZ is a novel promoter of metastasis and that it could be a potential prognostic indicator in patients with triple-negative breast cancer by suppressing lipid raft-dependent endocytosis of TGFbetaR2(PMID: 35115500). Downregulation of DGKZ suppresses tumorigenesis and progression of cervical cancer by facilitating cell apoptosis and cell cycle arrest(PMID: 33926342). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag37336 Product name: Recombinant human DGKZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 750-982 aa of NM_001199267.1 Sequence: LDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV Predict reactive species Full Name: diacylglycerol kinase, zeta 104kDa Calculated Molecular Weight: 104kDa，928aa Observed Molecular Weight: 104-124 kDa GenBank Accession Number: NM_001199267.1 Gene Symbol: DGKZ Gene ID (NCBI): 8525 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13574 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.