Proteintech, 84837-1-RR, CD53 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD53 (84837-1-RR) by Proteintech is a Recombinant antibody targeting CD53 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84837-1-RR targets CD53 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Ramos cells, IM-9 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells, Daudi cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information CD53 is also named as MOX44 and Tetraspanin-25 (Tspan-25). Tetraspanin CD53 is a member of the tetraspanin superfamily expressed exclusively within the immune compartment (PMID: 32440787). T cells depend on the phosphatase CD45 to initiate T cell receptor signaling. CD53 is shown to stabilize CD45 on the membrane and is required for optimal phosphatase activity and subsequent Lck activation. Together, CD53 as a regulator of CD45 activity required for T cell immunity (PMID: 35767951). CD53 is a marker for positively selected CD4+ CD8+ thymocytes (PMID: 11867561). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2182 Product name: Recombinant Human CD53 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 107-181 aa of NM_000560.4 Sequence: EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSN Predict reactive species Full Name: CD53 molecule Calculated Molecular Weight: 24kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_000560.4 Gene Symbol: CD53 Gene ID (NCBI): 963 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P19397 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.