Iright
BRAND / VENDOR: Proteintech

Proteintech, 84869-1-RR, PDE10A Recombinant monoclonal antibody

CATALOG NUMBER: 84869-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PDE10A (84869-1-RR) by Proteintech is a Recombinant antibody targeting PDE10A in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 84869-1-RR targets PDE10A in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PDE10A (Phosphodiesterase 10A) is a single member of the PDE10 protein family, and it catalyzes both cAMP and cGMP hydrolysis (PMID: 34550322). The literature on PDE10A has been focused on psychiatric and neurological disorders because PDE10A expression is enriched in the striatal region of the brain under normal conditions (PMID: 12967715). Moreover, PDE10A expression is induced in various human tumor cell lines and PDE10A inhibition suppresses tumor cell growth (PMID: 37232184). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12771 Product name: Recombinant human PDE10A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 434-779 aa of BC104860 Sequence: KLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED Predict reactive species Full Name: phosphodiesterase 10A Calculated Molecular Weight: 779 aa, 88 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC104860 Gene Symbol: PDE10A Gene ID (NCBI): 10846 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y233 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924