Iright
BRAND / VENDOR: Proteintech

Proteintech, 84871-4-RR, ALDH7A1 Recombinant monoclonal antibody

CATALOG NUMBER: 84871-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ALDH7A1 (84871-4-RR) by Proteintech is a Recombinant antibody targeting ALDH7A1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 84871-4-RR targets ALDH7A1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293T cells, A549 cells, A431 cells, mouse liver tissue, rat liver tissue Positive IP detected in: HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ALDH7A1(Alpha-aminoadipic semialdehyde dehydrogenase) is also named as ATQ1 and belongs to the aldehyde dehydrogenase family. It plays a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0383 Product name: Recombinant human ALDH7A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-398 aa of BC002515 Sequence: SLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHT Predict reactive species Full Name: aldehyde dehydrogenase 7 family, member A1 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC002515 Gene Symbol: ALDH7A1 Gene ID (NCBI): 501 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49419 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924