Proteintech, 84878-5-RR, TCB1 Recombinant monoclonal antibody

Size: 20ul / 100ul The TCB1 (84878-5-RR) by Proteintech is a Recombinant antibody targeting TCB1 in WB, IHC, IF-P, ELISA applications with reactivity to mouse samples 84878-5-RR targets TCB1 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: EL-4 cells, mouse thymus tissue, mouse brain tissue, mouse spleen tissue Positive IHC detected in: mouse spleen tissue, mouse thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2437 Product name: Recombinant Mouse TCB1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-140 aa of Sequence: EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLS Predict reactive species Full Name: TCB1 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 38 kDa Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P01852 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.