Proteintech, 84886-3-RR, MYCN Recombinant monoclonal antibody

Size: 20ul / 100ul The MYCN (84886-3-RR) by Proteintech is a Recombinant antibody targeting MYCN in WB, FC (Intra), ELISA applications with reactivity to human samples 84886-3-RR targets MYCN in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IMR-32 cells, human placenta tissue Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MYCN, also named as BHLHE37 and NMYC, is a transcription factor. It is primarily expressed in normal developing embryos and is thought to be critical in brain and other neural development. It is often amplified in human neuroblastomas. IR34A can suppress MYCN expression, it suggest MYCN has a role in cell growth. The expression of the MCYN is upregulated in a variety of human tumors, most frequently neuroblastoma, where the level of expression appears to increase as the tumor progresses. The calculated molecuar weight of MYCN is 50 kDa, but Phosphorylated MYCN is about 65-70 kDa. MYCN exsits two isoforms and MV of isoform is respectively 65 kDa and 45 kDa. (PMID: 19615087 ) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27224 Product name: Recombinant human MYCN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 289-464 aa of BC002712 Sequence: SNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC Predict reactive species Full Name: v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) Calculated Molecular Weight: 50 kDa Observed Molecular Weight: ~65 kDa GenBank Accession Number: BC002712 Gene Symbol: MYCN Gene ID (NCBI): 4613 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04198 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.