Proteintech, 84891-9-RR, AMACR/p504S Recombinant monoclonal antibody

Size: 20ul / 100ul The AMACR/p504S (84891-9-RR) by Proteintech is a Recombinant antibody targeting AMACR/p504S in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84891-9-RR targets AMACR/p504S in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information AMACR(Alpha-methyl acyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. A mitochondrial and peroxisomal enzyme catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing and can form a dimer of 70-75 kDa(PMID:21812041). Defects in AMACR cause alpha-methyl acyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4005 Product name: Recombinant Human AMACR/p504S protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 200-330 aa of NM_014324.6 Sequence: KLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPL Predict reactive species Full Name: alpha-methylacyl-CoA racemase Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: NM_014324.6 Gene Symbol: AMACR Gene ID (NCBI): 23600 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UHK6-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.