Iright
BRAND / VENDOR: Proteintech

Proteintech, 84893-5-RR, ARK5 Recombinant monoclonal antibody

CATALOG NUMBER: 84893-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ARK5 (84893-5-RR) by Proteintech is a Recombinant antibody targeting ARK5 in IF/ICC, ELISA applications with reactivity to human samples 84893-5-RR targets ARK5 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: A431 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NUAK1 is a member of the human adenosine monophosphate (AMP)-activated protein kinase family that has been identified as a key tumor cell survival factor. It is also named as ARK5, KIAA0537, OMPHK1 and belongs to the protein kinase superfamily. The physiological role of NUAK1 is potentially to suppress glucose uptake through negative regulation of INS signaling in oxidative muscle. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18832 Product name: Recombinant human NUAK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 515-662 aa of BC152462 Sequence: HSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKLN Predict reactive species Full Name: NUAK family, SNF1-like kinase, 1 Calculated Molecular Weight: 661 aa, 74 kDa GenBank Accession Number: BC152462 Gene Symbol: ARK5 Gene ID (NCBI): 9891 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O60285 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924