Iright
BRAND / VENDOR: Proteintech

Proteintech, 84899-5-RR, PSPH Recombinant monoclonal antibody

CATALOG NUMBER: 84899-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PSPH (84899-5-RR) by Proteintech is a Recombinant antibody targeting PSPH in WB, ELISA applications with reactivity to human, mouse, rat samples 84899-5-RR targets PSPH in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, MCF-7 cells, U-87 MG cells, HepG2 cells, NIH/3T3 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5972 Product name: Recombinant human PSPH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC063614 Sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE Predict reactive species Full Name: phosphoserine phosphatase Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC063614 Gene Symbol: PSPH Gene ID (NCBI): 5723 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P78330 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924