Product Description
Size: 20ul / 100ul
The PLCG1 (84941-1-RR) by Proteintech is a Recombinant antibody targeting PLCG1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
84941-1-RR targets PLCG1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293 cells, Jurkat cells, MCF-7 cells
Positive IHC detected in: human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: Jurkat cells, HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:5000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
Background Information
Phosphoinositide phospholipase C-gamma-1 (PLCG1) which belongs to the phosphoinositide-specific phospholipase C (PLC) family, is activated by many extracellular stimuli including hormones, neurotransmitters, and growth factors and modulates several cellular and physiological functions necessary for tumorigeneses such as cell survival, migration, invasion, and angiogenesis by generating inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG) via hydrolysis of phosphatidylinositol 4,5-biphosphate (PIP2) (PMID: 9242915). Phosphorylation is one of the key mechanisms that regulate the activity of PLC. PLCγ is activated by both receptor and non-receptor tyrosine kinases (PMID: 2472218). PLCγ forms a complex with EGF and PDGF receptors, which leads to the phosphorylation of PLCγ at Tyr771, 783, and 1248 (PMID: 1708307). It has also been shown that PKA-mediated phosphorylation at Ser1248 is inhibitory to PLCγ1 tyrosine phosphorylation and phospholipase activity in CD3-treated Jurkat cells (PMID: 1370476), suggesting that Ser1248 may be an allosteric regulator of PLCγ1 activity.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag27218 Product name: Recombinant human PLCG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 467-563 aa of Sequence: AEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH Predict reactive species
Full Name: phospholipase C, gamma 1
Calculated Molecular Weight: 149 kDa
Gene Symbol: PLCG1
Gene ID (NCBI): 5335
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P19174
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924