Proteintech, 84942-4-RR, SEC31A Recombinant monoclonal antibody

Size: 20ul / 100ul The SEC31A (84942-4-RR) by Proteintech is a Recombinant antibody targeting SEC31A in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 84942-4-RR targets SEC31A in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, Jurkat cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information COPII-coated vesicles mediate anterograde transport from the ER to the Golgi apparatus. COPII is composed of three parts: two coat protein complexes (Sec23/24 complex and Sec13/31 complex) and one small GTP-binding protein, Sar1 (PMID: 9568718). The sec31 subunit of the coat complex has been shown to be essential for vesicle formation and ER-Golgi transport (PMID: 10788476). Two mammalian homologs of yeast sec31p, Sec31A and Sec31B, share about 40% amino acid identity. Sec31A transcripts are ubiquitously and abundantly expressed. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12314 Product name: Recombinant human SEC31A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 758-1106 aa of BC084583 Sequence: AAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQRPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV Predict reactive species Full Name: SEC31 homolog A (S. cerevisiae) Calculated Molecular Weight: 1220 aa, 133 kDa Observed Molecular Weight: 118-140 kDa GenBank Accession Number: BC084583 Gene Symbol: SEC31A Gene ID (NCBI): 22872 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O94979 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.