Proteintech, 84952-5-RR, HERC4 Recombinant monoclonal antibody

Size: 20ul / 100ul The HERC4 (84952-5-RR) by Proteintech is a Recombinant antibody targeting HERC4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 84952-5-RR targets HERC4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HERC4, also known as HECT and RLD domain containing E3 ubiquitin protein ligase 4, is a protein encoded by the HERC4 gene in humans. HERC4 is a novel member of HERC family. The mRNA of HERC4 has been found in all examined tissues, with its levels being significantly higher in the brain and testis than in the placenta and heart. (PMID: 28430527) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4566 Product name: Recombinant human HERC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 723-1049 aa of BC039600 Sequence: NIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPDVGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSLI Predict reactive species Full Name: hect domain and RLD 4 Calculated Molecular Weight: 1049 aa, 118 kDa Observed Molecular Weight: 107 kDa GenBank Accession Number: BC039600 Gene Symbol: HERC4 Gene ID (NCBI): 26091 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q5GLZ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.