Iright
BRAND / VENDOR: Proteintech

Proteintech, 84971-3-RR, GS28 Recombinant monoclonal antibody

CATALOG NUMBER: 84971-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GS28 (84971-3-RR) by Proteintech is a Recombinant antibody targeting GS28 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84971-3-RR targets GS28 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, SK-BR-3 cells, NIH/3T3 cells, C6 cells, PC-12 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information GS28, also known as GOSR1, is a 28-kDa Golgi SNARE protein that participates in ER-Golgi and intra-Golgi transport. GS28 is considered to be a core component of the Golgi SNARE complex. (PMID: 8638159) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9021 Product name: Recombinant human GS28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC012620 Sequence: MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQV Predict reactive species Full Name: golgi SNAP receptor complex member 1 Calculated Molecular Weight: 28.6 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC012620 Gene Symbol: GS28 Gene ID (NCBI): 9527 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95249 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924