Iright
BRAND / VENDOR: Proteintech

Proteintech, 84982-1-RR, CEACAM6/CD66c Recombinant monoclonal antibody

CATALOG NUMBER: 84982-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CEACAM6/CD66c (84982-1-RR) by Proteintech is a Recombinant antibody targeting CEACAM6/CD66c in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84982-1-RR targets CEACAM6/CD66c in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HT-29 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HT-29 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CEACAM6, also known as CD66c, is a glycosylphosphatidylinositol (GPI)-linked cell surface protein that belongs to the CEACAM family of the immunoglobulin superfamily (PMID: 23903773). It is normally expressed on the surface of myeloid and epithelial surfaces and upregulated preferentially at the apical/luminal membranes of many tumors (PMID: 27595061; 35082925). CEACAM6 plays an important role in cell adhesion, proliferation, tumorigenesis, metastasis, and immunity (PMID: 31797958). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2450 Product name: recombinant human CEACAM6 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 35-320 aa of BC005008 Sequence: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 40-100 kDa GenBank Accession Number: BC005008 Gene Symbol: CEACAM6 Gene ID (NCBI): 4680 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P40199 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924