Iright
BRAND / VENDOR: Proteintech

Proteintech, 84984-1-RR, RNF135 Recombinant monoclonal antibody

CATALOG NUMBER: 84984-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RNF135 (84984-1-RR) by Proteintech is a Recombinant antibody targeting RNF135 in IF/ICC, ELISA applications with reactivity to human, rat samples 84984-1-RR targets RNF135 in IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IF/ICC detected in: PC-12 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Ring finger protein 135 (RNF135), located on chromosome 17q11.2, is a RING finger domain-containing E3 ubiquitin ligase that was identified as a bio-marker and therapy target of glioblastoma (PMID: 26856755). RNF135 facilitates RIG-I C-terminal ubiquitination to up-regulate RIG-I-mediated IFN signaling and suppress viral replication. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18821 Product name: Recombinant human RNF135 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-210 aa of BC005084 Sequence: MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT Predict reactive species Full Name: ring finger protein 135 Calculated Molecular Weight: 432 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC005084 Gene Symbol: RNF135 Gene ID (NCBI): 84282 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8IUD6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924