Proteintech, 84994-4-RR, RAF1 Recombinant monoclonal antibody

Size: 20ul / 100ul The RAF1 (84994-4-RR) by Proteintech is a Recombinant antibody targeting RAF1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84994-4-RR targets RAF1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, K-562 cells, HeLa cells, DU 145 cells, NIH/3T3 cells, PC-12 cells, RAW 264.7 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Raf-1 proto-oncogene, serine/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species Full Name: v-raf-1 murine leukemia viral oncogene homolog 1 Calculated Molecular Weight: 648 aa, 73 kDa Observed Molecular Weight: ~75 kDa GenBank Accession Number: BC018119 Gene Symbol: RAF1 Gene ID (NCBI): 5894 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04049 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.