Iright
BRAND / VENDOR: Proteintech

Proteintech, 84998-1-RR, ZNF618 Recombinant monoclonal antibody

CATALOG NUMBER: 84998-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ZNF618 (84998-1-RR) by Proteintech is a Recombinant antibody targeting ZNF618 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84998-1-RR targets ZNF618 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, SH-SY5Y cells, MCF-7 cells, Caki-2 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Zinc finger protein 618 (ZNF618) is a key protein associated with DNA methylation and acts as a specific 5hmC reader in vivo to regulate UHRF2 function by promoting UHRF2 chromatin localization. In addition, ZNF618 is not only associated with the induction, maintenance or progression of female breast cancer, but is also up-regulated in lung cancer cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag36487 Product name: Recombinant human ZNF618 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-382 aa of NM_001318042.1 Sequence: YSCFQEHRDLHAVDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHAPISTAPGWEPPDDPDTGSECSHPEVSPSPRFVAAKTQTNQSGKKAPASVVRCATLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN Predict reactive species Full Name: zinc finger protein 618 Calculated Molecular Weight: 105kDa,954aa Observed Molecular Weight: 110-130 kDa GenBank Accession Number: NM_001318042.1 Gene Symbol: ZNF618 Gene ID (NCBI): 114991 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5T7W0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924