Proteintech, 85035-2-RR, ICOS/CD278 Recombinant monoclonal antibody

Size: 20ul / 100ul The ICOS/CD278 (85035-2-RR) by Proteintech is a Recombinant antibody targeting ICOS/CD278 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85035-2-RR targets ICOS/CD278 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, rat thymus tissue, mouse spleen tissue, C2C12 cells, Jurkat cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Inducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3198 Product name: Recombinant Mouse ICOS/CD278 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-144 aa of NM_017480.2 Sequence: EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWL Predict reactive species Full Name: inducible T-cell co-stimulator Calculated Molecular Weight: 23kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: NM_017480.2 Gene Symbol: Icos Gene ID (NCBI): 54167 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9WVS0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.