Iright
BRAND / VENDOR: Proteintech

Proteintech, 85038-7-RR, NME1 Recombinant monoclonal antibody

CATALOG NUMBER: 85038-7-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NME1 (85038-7-RR) by Proteintech is a Recombinant antibody targeting NME1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 85038-7-RR targets NME1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, HepG2 cells, A549 cells, MCF-7 cells, Jurkat cells, C6 cells Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NME1 is also named as NDPKA(Nucleoside diphosphate kinase A), NM23(Metastasis inhibition factor nm23),GAAD(Granzyme A-activated DNase) and belongs to the NDK family.It is a major role in the synthesis of nucleoside triphosphates other than ATP and required for neural development including neural patterning and cell fate determination. It has 3 isoforms produced by alternative splicing. Refer to the epitope and protein detection, this antibody specifically recognizes NME1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1548 Product name: Recombinant human NME1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC018994 Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE Predict reactive species Full Name: non-metastatic cells 1, protein (NM23A) expressed in Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC018994 Gene Symbol: NME1 Gene ID (NCBI): 4830 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15531 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924