Iright
BRAND / VENDOR: Proteintech

Proteintech, 85049-4-RR, KCNA3 Recombinant monoclonal antibody

CATALOG NUMBER: 85049-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The KCNA3 (85049-4-RR) by Proteintech is a Recombinant antibody targeting KCNA3 in WB, ELISA applications with reactivity to human samples 85049-4-RR targets KCNA3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Kv1.3 ( also known as KCNA3, MK3, HGK5, HLK3, PCN3, HPCN3) contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, which allows nerve cells to repolarize following an action potential efficiently. It plays an essential role in T cell proliferation and activation. Kv1.3 channels are expressed in various tissues and cell types including the brain, vascular smooth muscle cells, and leucocytes. Malfunction of Kv1.3 can alter the immune response, elicit neurotoxic effects or impact on cancer growth(PMID: 24305723; 24133455). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5204 Product name: Recombinant human KCNA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-226 aa of BC035059 Sequence: DERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEY Predict reactive species Full Name: potassium voltage-gated channel, shaker-related subfamily, member 3 Calculated Molecular Weight: 575 aa, 64 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC035059 Gene Symbol: KCNA3 Gene ID (NCBI): 3738 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22001 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924