Iright
BRAND / VENDOR: Proteintech

Proteintech, 85057-2-RR, RGS12 Recombinant monoclonal antibody

CATALOG NUMBER: 85057-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RGS12 (85057-2-RR) by Proteintech is a Recombinant antibody targeting RGS12 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85057-2-RR targets RGS12 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, SH-SY5Y cells, THP-1 cells, NIH/3T3 cells, C6 cells, mouse brain tissue Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30731 Product name: Recombinant human RGS12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 833-962 aa of NM_198229 Sequence: LAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKATK Predict reactive species Full Name: regulator of G-protein signaling 12 Calculated Molecular Weight: 156 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: NM_198229 Gene Symbol: RGS12 Gene ID (NCBI): 6002 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14924 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924