Iright
BRAND / VENDOR: Proteintech

Proteintech, 85058-4-RR, STRN Recombinant monoclonal antibody

CATALOG NUMBER: 85058-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The STRN (85058-4-RR) by Proteintech is a Recombinant antibody targeting STRN in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 85058-4-RR targets STRN in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information STRN (Striatin), a 780-amino acid protein, was identified and cloned more than a decade ago. In adult mammals, striatin is mainly expressed in neurons of both the central and peripheral nervous systems with very high levels of expression in the striatum, hence its name. STRN-ALK fusion may be a potential therapeutic target in the aggressive forms of thyroid cancer (PMID: 24475247). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15984 Product name: Recombinant human STRN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-403 aa of BC106879 Sequence: NRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLTYDIANNKDALRKT Predict reactive species Full Name: striatin, calmodulin binding protein Calculated Molecular Weight: 780 aa, 86 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC106879 Gene Symbol: STRN Gene ID (NCBI): 6801 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43815 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924