Iright
BRAND / VENDOR: Proteintech

Proteintech, 85060-2-RR, GAT1 Recombinant monoclonal antibody

CATALOG NUMBER: 85060-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GAT1 (85060-2-RR) by Proteintech is a Recombinant antibody targeting GAT1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 85060-2-RR targets GAT1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: unboiled rat brain tissue Positive IHC detected in: mouse cerebellum tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29712 Product name: Recombinant human SLC6A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC033904 Sequence: MATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFD Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, GABA), member 1 Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC033904 Gene Symbol: GABA Transporter 1/GAT1 Gene ID (NCBI): 6529 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30531 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924