Iright
BRAND / VENDOR: Proteintech

Proteintech, 85062-4-RR, PTPN22 Recombinant monoclonal antibody

CATALOG NUMBER: 85062-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PTPN22 (85062-4-RR) by Proteintech is a Recombinant antibody targeting PTPN22 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 85062-4-RR targets PTPN22 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: Jurkat cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PTPN22(Tyrosine-protein phosphatase non-receptor type 22) is also named as LyP,PEP,PTPN8.It belongs to the protein-tyrosine phosphatase family and non-receptor class 4 subfamily.It acts as negative regulator of T-cell receptor (TCR) signaling.Defects in PTPN22 are a cause of susceptibility to systemic lupus erythematosus (SLE). It has some isoforms produced by alternative splicing with calculated molecular mass of 79-92 kDa, and apparent molecular mass of 100-110 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2397 Product name: Recombinant human PTPN22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC017785 Sequence: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF Predict reactive species Full Name: protein tyrosine phosphatase, non-receptor type 22 (lymphoid) Calculated Molecular Weight: 82 kDa, 92 kDa GenBank Accession Number: BC017785 Gene Symbol: PTPN22 Gene ID (NCBI): 26191 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y2R2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924