Proteintech, 85075-1-RR, PTK7 Recombinant monoclonal antibody

Size: 20ul / 100ul The PTK7 (85075-1-RR) by Proteintech is a Recombinant antibody targeting PTK7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85075-1-RR targets PTK7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, C2C12 cells, PC-12 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Protein tyrosine kinase 7 (PTK7), also known as colon carcinoma kinase 4 (CCK4), is an atypical receptor tyrosine kinase that consists of an extracellular domain with seven immunoglobulin-like domains, a transmembrane domain, and a catalytically defective tyrosine kinase domain (PMID: 29867084). It is implicated in planar cell polarity and the Wnt canonical and non-canonical pathways (PMID: 24618420). Overexpression of PTK7 has been reported in a variety of tumors, such as cervical cancer, colon cancer, lung adenocarcinoma, acute myelogenous leukemia, and gastric cancer (PMID: 30944666). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12026 Product name: Recombinant human PTK7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 724-1070 aa of BC071557 Sequence: FYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP Predict reactive species Full Name: PTK7 protein tyrosine kinase 7 Calculated Molecular Weight: 1070 aa, 118 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC071557 Gene Symbol: PTK7 Gene ID (NCBI): 5754 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13308 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.