Proteintech, 85081-4-RR, CEL Recombinant monoclonal antibody

Size: 20ul / 100ul The CEL (85081-4-RR) by Proteintech is a Recombinant antibody targeting CEL in WB, IHC, ELISA applications with reactivity to human samples 85081-4-RR targets CEL in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, Raji cells Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Bile salt-activated lipase, previously named cholesterol esterase or bile salt-stimulated (or dependent) lipase, is a 74 kDa lipolytic enzyme capable of hydrolyzing cholesteryl esters, tri-, di-, and mono-acylglycerols, phospholipids, lysophospholipids, and ceramide(PMID:12454261). The same enzyme is present as a major protein in milk and as a minor constituent in liver, activated macrophages, and endothelial cells(PMID:11733511). Defects in CEL are a cause of maturity-onset diabetes of the young type 8 with exocrine dysfunction (MODY8)(PMID:16369531). The full length protein has 11 glycosylation sites. It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5262 Product name: Recombinant human CEL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 371-722 aa of BC042510 Sequence: SEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF Predict reactive species Full Name: carboxyl ester lipase (bile salt-stimulated lipase) Calculated Molecular Weight: 79 kDa Observed Molecular Weight: 79 kDa GenBank Accession Number: BC042510 Gene Symbol: CEL Gene ID (NCBI): 1056 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P19835 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.