Iright
BRAND / VENDOR: Proteintech

Proteintech, 85112-4-RR, Progesterone Receptor Recombinant monoclonal antibody

CATALOG NUMBER: 85112-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Progesterone Receptor (85112-4-RR) by Proteintech is a Recombinant antibody targeting Progesterone Receptor in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 85112-4-RR targets Progesterone Receptor in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, T-47D cells Positive IHC detected in: human cervical cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: T-47D cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information PGR (Progesterone Receptor), also named as NR3C3 and PR, belongs to the nuclear hormone receptor family and NR3 subfamily. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Progesterone receptor isoform B (PRB) is involved activation of c-SRC/MAPK signaling on hormone stimulation. The ER and PR status has been used as a predictor of breast carcinoma responsiveness to endocrine therapy and as a prognostic indicator for early recurrence. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22986 Product name: Recombinant human PR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of NM_000926 Sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVM Predict reactive species Full Name: progesterone receptor Calculated Molecular Weight: 933 aa, 99 kDa Observed Molecular Weight: 118 kDa GenBank Accession Number: NM_000926 Gene Symbol: Progesterone Receptor Gene ID (NCBI): 5241 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P06401 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924