Iright
BRAND / VENDOR: Proteintech

Proteintech, 85121-4-RR, Adiponectin receptor Recombinant monoclonal antibody

CATALOG NUMBER: 85121-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Adiponectin receptor (85121-4-RR) by Proteintech is a Recombinant antibody targeting Adiponectin receptor in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 85121-4-RR targets Adiponectin receptor in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, L02 cells, rat uterus tissue, human placenta tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: rat liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:300-1:1200 Background Information Adiponectin is a hormone secreted by adipocytes that acts as an antidiabetic and anti-atherogenic adipokine. Two receptors for adiponectin (ADIPOR1 and ADIPOR2) have been identified. They mediate increased AMPK, MAPK, and PPARA ligand activity in response to adiponectin. AdipoR1 is abundantly expressed in skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver (PMID: 12802337). The human ADIPOR2 gene maps to chromosome 12p13.31, and encodes a 386-amino acid protein with a molecular weight of 44 kDa. AdipoR2 may also exist as stable ~ 60 kDa dimers (PMID: 18842004). This antibody raised against 1-147aa of human AdipoR2 may cross-react with AdipoR1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5744 Product name: Recombinant human ADIPOR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC051858 Sequence: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG Predict reactive species Full Name: adiponectin receptor 2 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC051858 Gene Symbol: Adiponectin receptor Gene ID (NCBI): 79602 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86V24 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924