Proteintech, 85128-6-RR, Foxp3 Recombinant monoclonal antibody

Size: 20ul / 100ul The Foxp3 (85128-6-RR) by Proteintech is a Recombinant antibody targeting Foxp3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 85128-6-RR targets Foxp3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, MJ cells, rat thymus tissue, mouse spleen tissue, rat spleen tissue Positive IHC detected in: mouse spleen tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Background Information FOXP3, also named as IPEX, JM2 and Scurfin, is a transcription factor. FOXP3 plays a critical role in the control of immune response. Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) which also known as X-linked autoimmunity-immunodeficiency syndrome. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4360 Product name: Recombinant Mouse Foxp3 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 10007378 of Sequence: YPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPS Predict reactive species Full Name: forkhead box P3 Observed Molecular Weight: 45 kDa Gene Symbol: Foxp3 Gene ID (NCBI): 20371 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99JB6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.