Proteintech, 85132-2-RR, Complement factor H Recombinant monoclonal antibody

Size: 20ul / 100ul The Complement factor H (85132-2-RR) by Proteintech is a Recombinant antibody targeting Complement factor H in WB, ELISA applications with reactivity to human samples 85132-2-RR targets Complement factor H in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Complement factor H (CFH) is an abundant plasma glycoprotein that regulates the function of the alternative complement pathway in the fluid phase and on cellular surfaces (PMID: 2963625). Factor H binds to C3b, accelerates the decay of the alternative pathway C3-convertase (C3bBb), and acts as a cofactor for the factor I-mediated proteolytic inactivation of C3b (PMID: 15163532). It plays a critical role in the homeostasis of the complement system in plasma and in the protection of bystander host cells and tissues from damage by complement activation. Abnormalities in factor H have been associated with renal disease (PMID: 18190458). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3753 Product name: Recombinant Human Complement factor H protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 860-1231 aa of Sequence: SIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR Predict reactive species Full Name: complement factor H Calculated Molecular Weight: 139kDa Observed Molecular Weight: 140-150 kDa Gene Symbol: Complement factor H Gene ID (NCBI): 3075 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08603-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.