Proteintech, 85140-2-RR, TINAGL1 Recombinant monoclonal antibody

Size: 20ul / 100ul The TINAGL1 (85140-2-RR) by Proteintech is a Recombinant antibody targeting TINAGL1 in WB, ELISA applications with reactivity to human samples 85140-2-RR targets TINAGL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Tubulointerstitial nephritis antigen-like 1 (Tinagl1), a secreted extracellular protein, was initially identified as a putative component of the ECM. Tinagl1 is most commonly associated with embryonic development, including the heart and adrenal glands. Low levels of Tinagl1 expression can be dire for craniofacial development and for female fertility. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2721 Product name: Recombinant human TINAGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC009048 Sequence: MTPVLSPQNLLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKYWTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH Predict reactive species Full Name: tubulointerstitial nephritis antigen-like 1 Calculated Molecular Weight: 467 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC009048 Gene Symbol: TINAGL1 Gene ID (NCBI): 64129 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9GZM7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.