Proteintech, 85143-5-RR, GBE1 Recombinant monoclonal antibody

Size: 20ul / 100ul The GBE1 (85143-5-RR) by Proteintech is a Recombinant antibody targeting GBE1 in WB, ELISA applications with reactivity to human, mouse, rat samples 85143-5-RR targets GBE1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse lung tissue, rat lung tissue, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GBE1 (glucan (1,4-alpha-), branching enzyme 1) is essential for the globular and branched structure of glycogen, increasing solubility by creating a hydrophilic surface and reducing intracellular osmotic pressure. It may serve as a potential therapeutic target for treating LUAD(PMID: 31221150). The full sequence can be further processed into a mature form of 75 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14154 Product name: Recombinant human GBE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC012098 Sequence: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNM Predict reactive species Full Name: glucan (1,4-alpha-), branching enzyme 1 Calculated Molecular Weight: 702 aa, 80 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC012098 Gene Symbol: GBE1 Gene ID (NCBI): 2632 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04446 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.